PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID mrna25685.1-v1.0-hybrid
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Rosoideae; Potentilleae; Fragariinae; Fragaria
Family MYB
Protein Properties Length: 314aa    MW: 35606 Da    PI: 9.0323
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
mrna25685.1-v1.0-hybridgenomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding57.14.1e-181461148
                             TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
          Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                             +g+WT+eEd++l+d+++ +G g+W++ ++  g+ R++k+c++rw +yl
  mrna25685.1-v1.0-hybrid 14 KGAWTKEEDQRLIDYIRIHGEGCWRSLPKQAGLLRCGKSCRLRWINYL 61
                             79******************************99************97 PP

2Myb_DNA-binding59.76.3e-1967111147
                              TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
          Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                              rg++T+eEdel+++++ +lG++ W++Ia +++ gRt++++k++w+++
  mrna25685.1-v1.0-hybrid  67 RGNFTEEEDELIIKLHSLLGNK-WSLIAGRLP-GRTDNEIKNYWNTH 111
                              89********************.*********.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.0E-24564IPR009057Homeodomain-like
PROSITE profilePS5129417.744961IPR017930Myb domain
SuperFamilySSF466897.55E-3013108IPR009057Homeodomain-like
SMARTSM007174.1E-141363IPR001005SANT/Myb domain
PfamPF002493.7E-161461IPR001005SANT/Myb domain
CDDcd001675.80E-111661No hitNo description
PROSITE profilePS5129429.42762116IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.6E-2865116IPR009057Homeodomain-like
SMARTSM007174.6E-1866114IPR001005SANT/Myb domain
PfamPF002494.2E-1767111IPR001005SANT/Myb domain
CDDcd001671.38E-1269112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009611Biological Processresponse to wounding
GO:0009651Biological Processresponse to salt stress
GO:0009737Biological Processresponse to abscisic acid
GO:0009751Biological Processresponse to salicylic acid
GO:0090378Biological Processseed trichome elongation
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 314 aa     Download sequence    Send to blast
MGRSPCCEKA HTNKGAWTKE EDQRLIDYIR IHGEGCWRSL PKQAGLLRCG KSCRLRWINY  60
LRPDLKRGNF TEEEDELIIK LHSLLGNKWS LIAGRLPGRT DNEIKNYWNT HIKRKLLTRG  120
LDPQTHRPLN EAGAAATAAT AASRLDFRNG SPPFLSVEKI NSLMDQTNFK NNNNNNSTNN  180
NKKMNLLFKP KKEEEYSYNK NMNNFEEANC SSSGTTTEED QQQQQKPDIM YKCGDLNLDL  240
SIGLEPFQSE PTRASSGNSA ESKLTRRASN NYDMFAQAAA VCLCCQVGFQ SSEARRSCQC  300
TNGFYRFRRP LNS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A3e-30141187110B-MYB
1h8a_C4e-301311626128MYB TRANSFORMING PROTEIN
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00053PBMTransfer from AT1G22640Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004299892.10.0PREDICTED: transcription repressor MYB6
SwissprotQ9S9K91e-97MYB3_ARATH; Transcription factor MYB3
TrEMBLM5XRH51e-154M5XRH5_PRUPE; Uncharacterized protein
STRINGPOPTR_0019s11090.11e-113(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF26434221
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G09460.11e-90myb domain protein 6